SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008251 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008251
Domain Number 1 Region: 176-434
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-56
Family Protein kinases, catalytic subunit 0.00000128
Further Details:      
 
Domain Number 2 Region: 74-209
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-22
Family SH2 domain 0.0000468
Further Details:      
 
Domain Number 3 Region: 8-94
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000122
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008251   Gene: ENSMPUG00000008313   Transcript: ENSMPUT00000008382
Sequence length 444
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:8355810:8361948:-1 gene:ENSMPUG00000008313 transcript:ENSMPUT00000008382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASWDQAPLGPQHVGLWDFEARRDEERTFRAGHLFHVAGKEGRRWRAAPLDAEGRPLTEG
CMPHNYLAEKETVESELWFFGPISRLEAQHCLQAEGSVAASLVRVGQKPGADYSLSVRDR
QAMRHYRVWCRAGRLHLSEAASYPSLAELLGHHKGRSLSHGLPRTVPCRKPEPEPPPHWA
DWQRPHEEFRLCRKLGSGYFGGVFEGIWKDRVQVAIKVIARDNLLHQHTFQAEIQATKKL
QHKHILVLCAAASVGDPYIVPELLAKGSLLELLRDSEKSLPVSELVDIASQVAEGMCYLQ
SQNYVHRDLATRNILVGAHNICKVGDFGLARFIQDEREAAHGQGRPGRWHRPSKCSYGHT
DVRSFRILHQETFSRGSIPYPGTSRHEAFQRVESGYRMPCPPERPAAAAHKLMLSCWHRD
PEHRPCFQAVPEKLSSVSTYENPL
Download sequence
Identical sequences M3YA94
ENSMPUP00000008251 ENSMPUP00000008251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]