SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008286 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008286
Domain Number 1 Region: 231-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-78
Family Protein kinases, catalytic subunit 0.000000182
Further Details:      
 
Domain Number 2 Region: 119-264
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-32
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 52-139
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000853
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008286   Gene: ENSMPUG00000008349   Transcript: ENSMPUT00000008419
Sequence length 507
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:8362712:8371479:-1 gene:ENSMPUG00000008349 transcript:ENSMPUT00000008419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFLRRRLTFLSFFWDKIWPVAAPDDGVPGLPDPVAGAEPEPAATEPCSPPAPPQLFRV
LYDFTARCSAELSVSRGDRLCALREDGDYIFARRLSGPPGTGLVPITHLARATPETPSDP
PWYFSSMSRARAQQLLLSPASAPGAFLVRPSESSRGDYSLSVRAQAKVHHYRISTAAGGL
YLQKGRLFPSLEELLAYYKANWKLTQSPLLQPHVPQGAAGRGPERPPPPQRPPQQDEWER
PRSEFALRRKLGEGCFGEVWEGLWLGSTPVAVKVIKSAYMKLADLSKEIQTLKSLRHERL
IQLHAVCSAGQPVYIVTELMRKGSLQAFLGSPEGRALDLPLLLSFACQVAEGMSYLEGRR
IVHRDLAARNVLVGDDLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRIYSQ
KSDVWSFGVLLYEVFTYGQCPYEGLSNHETLQQVMRGYRLPRPAPCPAEVYALMLECWKG
SPEERPAFAALQEKLSAAHRRLAPAHT
Download sequence
Identical sequences M3YAC9
XP_012915586.1.14098 ENSMPUP00000008286 ENSMPUP00000008286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]