SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008839 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008839
Domain Number 1 Region: 227-339
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-20
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008839   Gene: ENSMPUG00000008909   Transcript: ENSMPUT00000008983
Sequence length 355
Comment pep:novel scaffold:MusPutFur1.0:GL896905.1:25005979:25013805:1 gene:ENSMPUG00000008909 transcript:ENSMPUT00000008983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLRGSKLQLEPPVPPPRYVVPCPDSPAWNKGAPSPSPWPTPGTSRFEGEEEEDEDEYE
LPPCEALPFSLAPAHLPDTEEDSVYLDHAGPVGASKSPPPQPQATTVNSTLPQAPPSPPT
RPGYPFPGCKSKRHLICKISPIFAFKRPGTQVPGLPKKPDNNVYVECESSPVPALTRTLS
SQVLMPPISLPRISMVPRPTVAPQEARNGAANATSKAGRRSSFSSRAPTWSTSTAEDGSL
LGQPWYSGNCDRHAVESALLQVQKDGAYTVRPSSEPHSSQPLTLAVLLHGRVFNIPIRQL
DGGRHYALGRQGRNNEELFPSVVAMVQHYTQHPLPLVDRYSHRCQLTCLLFPTKP
Download sequence
Identical sequences M3YBY2
ENSMPUP00000008839 ENSMPUP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]