SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008896 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008896
Domain Number 1 Region: 5-167,194-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.2e-56
Family FCH domain 0.0082
Further Details:      
 
Domain Number 2 Region: 481-673
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 727-787
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008896   Gene: ENSMPUG00000008967   Transcript: ENSMPUT00000009041
Sequence length 928
Comment pep:novel scaffold:MusPutFur1.0:GL897267.1:201258:236061:-1 gene:ENSMPUG00000008967 transcript:ENSMPUT00000009041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWQLGEQLRCLELQGELRRELLQELAEFLRRRAEVELEYSRGLDKLAERFSGRGGRLGG
SSREHQSFRKEPSLLSPLHCWAVLLQQTRQQSRESATLGEVLAGPLAQRLSHIAEDVGRL
VKKSKDLEQQLQEELLEVVSELQTAKKTYQLYHTESMNAEAKLREAERQEEKRAGRSATS
APAPATDTGTLRKSSLKKGGRLVEKRQAKFLEHKLKCTKARNEYLLSLASVNAAVSNYYL
HDVMDLMDCCDTGFHVALAQLLRSYVVAESRAQVSHMQGLGSLEEAVEALDPSGDKAKVL
EVHAVAFCPPQRFDYHPHEGDEVAEIRLEMELRDEILPRAQNIQSRLDRQTIETEEVSKT
LKATLQVLLEAVAAEDGDALDSLQASPSTESLKSTSSDAGARQAGRRRGQQQETETFYIT
KLQEYLSGRSVLAKLQAKHEKLQEAIQRGDKDEQDVSWAQYTQRKQQKSRRPRPSSQYNQ
KLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQPRVSEIRDAFERGE
DPLVEGCTPHDLDAVAGVLKLYFRSLDPPLFPPDLFGELLASAELEAVAERVEHVGRLLT
QLPAPTLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVALQGRVNQ
LVQTLIVQPSRVFPPVAVLPGPTYEKCMAPPSSGCLGDAQLEGLAGDNEPELEAGTMAQE
DDLEGVMEAVACFAYTGRTAQELSFQRGDVLRLHERASGDWWRGECAGARGLIPHKYITL
PGSAEKHTVAQGPRAAGEPVSSPEILLAMEFIHRPEPCTPPEAPLGTSGGPSGHRRHCLV
PTSPERYVEVDKAVAQTMDSVFKELLGKTSARQGLGLASTCSPGPGPCSLKPPACSRLGK
NKSLSRGSGVLAPPSASRPQSPDSPLKH
Download sequence
Identical sequences M3YC39
XP_004780748.1.14098 ENSMPUP00000008896 ENSMPUP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]