SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009068 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009068
Domain Number 1 Region: 148-349
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000946
Further Details:      
 
Domain Number 2 Region: 35-192
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-32
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009068
Domain Number - Region: 624-690
Classification Level Classification E-value
Superfamily Tropomyosin 0.00036
Family Tropomyosin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009068   Gene: ENSMPUG00000009144   Transcript: ENSMPUT00000009220
Sequence length 710
Comment pep:novel scaffold:MusPutFur1.0:GL897014.1:4797614:4935049:-1 gene:ENSMPUG00000009144 transcript:ENSMPUT00000009220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRLPCPRRLGPVLKEGWLKRQRSIMKNWQQRWFV
LRGDQLFYYKDKDETKPQGFISLQGTRVTELLPGPEDAGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEDTVHHERKYGPRLAPLLVEQCV
DFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPE
PVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSSLPLANYNLLRYICKFLDEVQSHSNV
NKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHSQLFTARAEEGPTSP
RGGPPCTVGWGSEEGPRDGQPEPSSPSSPSSPGLPSHRTSSLDGATVAALSRTSPTGLGT
RGGPAAPSPGKKVQTLPNWKSSFWQSGSRSGSPKAGSSSLEVPIISSGGNWLMNGLSSLR
GHRRASSGERLKDSGSSQRLSTYDNVPPPSGLFPSTPSVASTVWSGASSCEASARGSVSS
YTACRASDSSACSSLHTEGALEPSPFPSSSEERRSPDLGRGLDEVGTCISSSEPSDPGSP
TQDYARCSEALQGLVTELRAELCRQRTEYETSIKRLEEGSANLRKRMSRLEEELDQEKKK
YTMLEIKLRNSERAREDAEKRNQLLQKEMEEFFSTLGSLTVGARGDKAPK
Download sequence
Identical sequences M3YCL1
ENSMPUP00000009068 ENSMPUP00000009068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]