SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009167 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009167
Domain Number 1 Region: 313-479,870-1046
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.23e-123
Family Mammalian PLC 0.00000741
Further Details:      
 
Domain Number 2 Region: 622-737
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-30
Family SH2 domain 0.000023
Further Details:      
 
Domain Number 3 Region: 529-641
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-25
Family SH2 domain 0.00039
Further Details:      
 
Domain Number 4 Region: 1063-1184
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-23
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 5 Region: 16-130
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-20
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 6 Region: 766-831
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-18
Family SH3-domain 0.00024
Further Details:      
 
Domain Number 7 Region: 160-310
Classification Level Classification E-value
Superfamily EF-hand 0.0000000754
Family Calbindin D9K 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009167   Gene: ENSMPUG00000009243   Transcript: ENSMPUT00000009320
Sequence length 1266
Comment pep:known scaffold:MusPutFur1.0:GL896939.1:6163889:6301425:-1 gene:ENSMPUG00000009243 transcript:ENSMPUT00000009320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPANVDTLPEHEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKVVHQKKDCCFTIFYGTQFVLSTLSLAADSKEDAS
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSVSSEFPVQTSGFIYDSNTDRPDAS
AVYLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSREN
SIWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRAGCRCIELD
CWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMAR
VFKEVFGDQLLTKPTEASADQLPSPSQLREKFIIKHKKLGPRGDVDVNMEDKKDEHKQQG
ELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEK
RTSAERLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKY
FLTDNVTFTSIYDLIQHYRETHLRCTEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDM
LMRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSY
YEKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEISPSMPQRTVKALYD
YKAKRNDELSFCRGALIHNVSKEPWGWWRGDYGTRIQQYFPSNYVEDISTADVEELEKQI
IEDNPLGSLCRGILDLNTYNVVKAPHGKNQKQFVFILEPKKQGDPPVEFATDKVEELFEW
FQSIREITWKMDTKENSMKYWEKNQSIAIELSDLVVYCKPTSKAKDNLENPDFREIRSFV
ETKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDK
YMQMNHALFSLNGRTGYVLQPESMRSEQYDPMPPENQRKILMTLSVKVLGARHLPKLGRS
IACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEE
DMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSS
CRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVS
NSRFYS
Download sequence
Identical sequences M3YCW0
ENSMPUP00000009167 ENSMPUP00000009167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]