SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009691 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009691
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009691   Gene: ENSMPUG00000009766   Transcript: ENSMPUT00000009848
Sequence length 971
Comment pep:known scaffold:MusPutFur1.0:GL896911.1:16256218:16311144:1 gene:ENSMPUG00000009766 transcript:ENSMPUT00000009848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDLKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSITEQAGSSVLHKLE
SGEQAFHEALEKGITAVKERRDVNELSEEEEEDEKLEHIEELPEEGAEKSSDMAEVVQLR
MTENILEPSSVTASTSAHLSPISILPASADILERTIRAAVEQHLFDLQSSIDHDLKNLQQ
QSLVCNNEAESFNCDGEGSNNQVDIADDIINASESNRDCSEPVASTNLDNEVMQQDFVFE
DEENSQSVGILLEPCSDRGDSEDGCLEGKEYVSFDSDTLSHLILDSSSKICDLNANTESE
VPGGQSVGVQGEAACGTQIPHLDLKNVSDGDKWEASCPITFPLIDFKTMHLQRDGEEPFP
AFKSWQEDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQSQRFLHDPETLDSSS
KALSFTRIRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDIAANP
KVLKWMTELTKLRKQIKDAKHKSSDGEFVPQTRPRSNTLPKSFGSSLYHEDEENEDESRV
IQKEKKPSKEATLELILKRLKEKRVERCLPEDIKKMTKDHLIEEKTSLQKSLLYYESQHG
RPVTREERHIVKPLYERYRLVKQMLTRVSITPVLGSPSSKRRGQMLQPIIEGETAHFFEE
IKEEEEDGVTLSSELTDILKTAVQAQSSLENSESDVEENQEKLALDLRLSSTRAASMPEL
LEQLWKARAEKKKLRKTLREFEEAFYQQNGRNAQKEDRVPVLEEYKEYKKIKAKLRLLEV
LISKQDSSKSI
Download sequence
Identical sequences M3YED4
ENSMPUP00000009691 XP_004744952.1.14098 ENSMPUP00000009691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]