SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009754 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009754
Domain Number 1 Region: 977-1154
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 546-663
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00089
Further Details:      
 
Domain Number 3 Region: 211-218,293-430
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-31
Family Pleckstrin-homology domain (PH domain) 0.00098
Further Details:      
 
Domain Number 4 Region: 688-859
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 5 Region: 1288-1432
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000672
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 6 Region: 10-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000388
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 7 Region: 454-547
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000428
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 8 Region: 873-1003
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000182
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009754
Domain Number - Region: 1198-1271
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00186
Family Ras-binding domain, RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009754   Gene: ENSMPUG00000009828   Transcript: ENSMPUT00000009911
Sequence length 1450
Comment pep:novel scaffold:MusPutFur1.0:GL897030.1:3880616:3924758:1 gene:ENSMPUG00000009828 transcript:ENSMPUT00000009911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARDVALSVTEWLRALHLEQYAGLFEQHGLVWATDCQGLSDARLLDMGMLLPGHRRRI
LAGLLRTHTPPTPAPRPSPRPVPMKRHVFRSPPAPAAPPAAPAPVEPEPKAGEEEGLPTA
PPIPPRRSCLPPACFSAPLAAVPDPALPPLPAKRHLAELSVPPVPPRTGPPRLLVSPPSK
EEELLSPPLSSPPQPEPEEPPATFPRGPPQPPSPPPSPPEIPPKPLRLPPEFDDSDYDEV
PEEGPGAPAGLMTKKEELPVSHIPRAVRVASLLSEGEELSEDDDQGDEDEDDHAYEGIPN
GGWHTSSLSSSLPSSLLIPELPPHPMDGHPVGPAPITPVIKAGWLDKNPPQGSYIYQKRW
VRLDADHLRYFDSNKDAYSKRFISVACISRVAAIGDQKFEVITNNRTFAFRAESDAERKE
WMQALQQAVAQQGARARLSSTYPLGVRDSELPDHAGSLELRGFKNKLYVAVVGDKVQLYK
NLEEYHLGIGITFIDMSVGNVKEADRRSFDLTTPYRIFSFSAESELEKEQWLEAMQGAIA
EALSTSEVAERIWAVAPNRFCADCGAAQPDWASINLCIVICKRCAGEHRGLGAGVSKVRS
LKMDRKVWTETLIELFLQLGNGAGNRFWAANVPPSEALQPNSSPGARRHHLEAKYREGKY
RRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVNCFSGDPEAPTPLALAEQAGQ
ILQMEFLRNNRTTEVPRLDSVKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEF
SRRWCVLSDGVLSYYENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYL
FGLESAELAREWVKCIAKAFIPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLTGS
ELRAVFPEGPCEEPLQLRKLQELSVQGDSENQVLVLVERRRTLYIQGERRLDFTGWLGAI
QKAAASSGDTLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLR
QDARSVRLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLDTSEIEDEEEKISRYRE
LLARLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGRVVE
DLIGHYVVVFSVDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKADTEQ
HVKIPASMTAEELTLEILDRRNVGIRERDYWTCFEVNEREEAERPLHFAEKVLPILHGLG
TDSYLVVKKHQSMEAMLLYLASHVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSS
CLRLYKEIRSHRPEKEWPVRSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCET
QMELREWFATFLFVQHDGLVWPSEPSRVSRAAPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV
Download sequence
Identical sequences M3YEJ7
ENSMPUP00000009754 ENSMPUP00000009754 XP_012919726.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]