SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009813 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009813
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.24e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 6.03e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009813
Domain Number - Region: 931-971
Classification Level Classification E-value
Superfamily UBA-like 0.000135
Family UBA domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009813   Gene: ENSMPUG00000009887   Transcript: ENSMPUT00000009972
Sequence length 983
Comment pep:novel scaffold:MusPutFur1.0:GL897041.1:2066297:2284620:-1 gene:ENSMPUG00000009887 transcript:ENSMPUT00000009972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPHPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDVFG
TNQSVGCRLLGDGSPKPGITASSNVNGRHSRMGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPAATLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPPRSCDNGHCILNGTHGTSSEMKKSNIPELGIYLKGDVFDSASDPVPLP
PARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPP
GSNSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYDQLPSSSDGS
QAPARPPKPRPRRTAPEIHHRKPHGPDASLENVDAKIAKLMGEGYAFEEVKRALEIAQNN
VEVARSILREFAYPPPVSPRLNL
Download sequence
Identical sequences M3YEQ6
XP_004769165.1.14098 XP_004769166.1.14098 ENSMPUP00000009813 ENSMPUP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]