SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009909 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009909
Domain Number 1 Region: 74-261
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000194
Further Details:      
 
Domain Number 2 Region: 422-526
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-27
Family SH2 domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009909   Gene: ENSMPUG00000009984   Transcript: ENSMPUT00000010069
Sequence length 539
Comment pep:known scaffold:MusPutFur1.0:GL897163.1:1836799:1869581:1 gene:ENSMPUG00000009984 transcript:ENSMPUT00000010069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSRGSADPSPTPTLANPLRVPPRSAASLAPPFPPARAPRPPSLCFPAVSPTPGRGRGSR
GGRGPTLGFGALAFADADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEILR
SMRSLDFNTRTQVTREAINRLHEAVPGIRGSWKKKAPNKALASILGKSNLRFAGMSIAVS
ISTDGLNLSVPATRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCGG
VAQSVISTVGQAFELRFKQYLHSPPRVVVAPERLTRPEDSAWGDEEESEHNYYNSIPGKE
PPLGGLVDSRLALTQPSALGALSQGASPARRDTCSLPWDLGAPSAGPPGDGYVQADTRGP
RDYEDHLYVNTQGLDTPDVLQPEDSPKKDLFDMRPFEDALKLHECSVGLGTAAAPLPSED
QWLSPPTRRAPIAPTEEQLRQEPWYHGQMSRRAAERLLRADGDFLVRDSVTNPGQYVLTG
MHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDYHLQSGQPIVAAESELHLRGVVRREP
Download sequence
Identical sequences M3YF02
ENSMPUP00000009909 ENSMPUP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]