SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010450 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010450
Domain Number 1 Region: 225-482
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.24e-99
Family STAT DNA-binding domain 0.0000593
Further Details:      
 
Domain Number 2 Region: 35-230
Classification Level Classification E-value
Superfamily STAT 7.65e-55
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 483-605
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-34
Family SH2 domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010450   Gene: ENSMPUG00000010528   Transcript: ENSMPUT00000010619
Sequence length 691
Comment pep:known scaffold:MusPutFur1.0:GL897072.1:3760219:3779840:1 gene:ENSMPUG00000010528 transcript:ENSMPUT00000010619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVRCIRHILYNEQRLVREANNGTSPVGSLADTMSQKHLQINQTFEELRLVTQDTENEL
KKLQQTQEYFIIQYQESLRIQAQFAGLNQLSPQERLSRETALQQKQVSLEAWLQHEAQTL
QQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKL
AEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVL
KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCV
MEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTL
SLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSN
RGLTKENLVFLAQKLFNSSSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLK
KHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWN
LMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSRYYTPVPCEPATAKAVDGYVKP
QIKQVVPEFVNASADSAGASATYMDQAPSPAVCPPAHYNMYPQNPDPVLDNDGDFDLDDT
MDVARRVEELLGRPMDSSRLSLPLRSRPTPP
Download sequence
Identical sequences M3YGJ3
ENSMPUP00000010450 ENSMPUP00000010450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]