SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010748 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010748
Domain Number 1 Region: 232-370
Classification Level Classification E-value
Superfamily SH2 domain 4.54e-27
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 2 Region: 116-166
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-21
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 197-275
Classification Level Classification E-value
Superfamily SH3-domain 4.67e-20
Family SH3-domain 0.0000285
Further Details:      
 
Domain Number 4 Region: 5-60
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010748   Gene: ENSMPUG00000010836   Transcript: ENSMPUT00000010927
Sequence length 380
Comment pep:known scaffold:MusPutFur1.0:GL897003.1:4106151:4180616:-1 gene:ENSMPUG00000010836 transcript:ENSMPUT00000010927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTKRKTSARDASPTPSTDAEYPANGGGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEMDEAAAESPSFL
SLRKGASMSNGQGARVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPSHAPQISYAGPACSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
Download sequence
Identical sequences D2GWY7 M3YHE1
ENSMPUP00000010748 XP_002913548.1.58354 XP_004764422.1.14098 XP_004764423.1.14098 XP_008697303.1.72690 XP_008697304.1.72690 XP_008697305.1.72690 XP_008697306.1.72690 XP_008697307.1.72690 XP_008697308.1.72690 XP_011229447.1.58354 XP_019660625.1.58354 ENSAMEP00000014015 ENSMPUP00000010748 ENSAMEP00000014015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]