SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011006 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011006
Domain Number 1 Region: 347-468
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 226-306
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.0000304
Family ATP sulfurylase catalytic domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011006   Gene: ENSMPUG00000011096   Transcript: ENSMPUT00000011190
Sequence length 474
Comment pep:novel scaffold:MusPutFur1.0:GL896926.1:11365114:11384503:-1 gene:ENSMPUG00000011096 transcript:ENSMPUT00000011190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGAPPAGSGPGQRAQGSAGSGPGGSRRGAGGAGAGPGGGGSGGVAKWLREHLGFRGG
GSGGGGGKPAPPEPDYRPPAPSPAAPPAPPPDILAAYRLQRERDFEDPYSGGPSSSAAAP
ATPAVPGPTPPPRHGSPPHRLIRVETPGPPAPPPEERISGPPASSDRGFCPPHVSPPPSP
RAESASCWSPRKELSRRDQLAILEDYADPFDVQETGEGPAGASGAPEKVPENDGYMEPYE
AQKMMAEIRSSKETAAQALPLYDTPYEPEEEGTTPEGEGAVWPRESRLPEDDERPPEEYD
QPWEWKKERISKAFAAQFEGSEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSVEPSSPLG
EWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMH
MKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences M3YI49
ENSMPUP00000011006 ENSMPUP00000011006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]