SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011220 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011220
Domain Number 1 Region: 340-594
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-72
Family Protein kinases, catalytic subunit 0.000000000476
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-30
Family SH2 domain 0.000000457
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-29
Family SH2 domain 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011220   Gene: ENSMPUG00000011312   Transcript: ENSMPUT00000011408
Sequence length 616
Comment pep:novel scaffold:MusPutFur1.0:GL896935.1:5958004:5977455:-1 gene:ENSMPUG00000011312 transcript:ENSMPUT00000011408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKDACPNTSASAEAAAPTLPAHPSTLTHAHRRIDTSSDGYTPEPARLVSSE
KAQSMPMDTSVYESPYSDPEELKDKKLFLKRDNLLMADIELGCGNFGSVRQGVYRMRKKQ
IDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLH
KFLLGKKEDIPISNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLS
KALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKM
KGPEVINFIEQGKRMECPAECPPEMYALMSDCWIYKWEDRPDFQAVEQRMRTYYYSVASK
AEGPPGCGKGPEAASA
Download sequence
Identical sequences M3YIR3
XP_004752969.1.14098 XP_012911757.1.14098 XP_012911758.1.14098 XP_012911759.1.14098 XP_012911760.1.14098 ENSMPUP00000011220 ENSMPUP00000011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]