SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012215 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012215
Domain Number 1 Region: 161-348
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-57
Family Phosphotyrosine-binding domain (PTB) 0.000000389
Further Details:      
 
Domain Number 2 Region: 491-612
Classification Level Classification E-value
Superfamily SH2 domain 9.83e-26
Family SH2 domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012215   Gene: ENSMPUG00000012311   Transcript: ENSMPUT00000012415
Sequence length 624
Comment pep:known scaffold:MusPutFur1.0:GL896926.1:14918427:15055597:-1 gene:ENSMPUG00000012311 transcript:ENSMPUT00000012415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDESSPAGSVGNKGSPQPPY
PTLAPHLPAAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKL
QESQDPAPSSPASPETGLNRAGSAPPPQPDLVGHRATVLTPDACPLPGPGEPTPGSRQDR
HFLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAIKKR
KPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDPD
TTDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSFESEE
VPSDGPSEEREDPEYYNEIPGKQPPAGGVSDVRLKVQATEHMAYCPIRCEKLCYLPGNSK
CSSVYENCLEQSRAIGNAPERGVQSHRDSSLMKQTCRVDFFNDPCYINTQALQSRLGSAP
NQGSAHPLGSPWHREKAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESL
LVKDGDFLVRESVTSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMD
NSLPIISSGSEVSLKQPVRKENNP
Download sequence
Identical sequences M3YLK8
XP_004751405.2.14098 ENSMPUP00000012215 ENSMPUP00000012215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]