SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012436 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012436
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.11e-110
Family STAT DNA-binding domain 0.000000000296
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 3.14e-64
Family STAT 0.0000000133
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.18e-45
Family Transcription factor STAT-4 N-domain 0.000017
Further Details:      
 
Domain Number 4 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-43
Family SH2 domain 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012436   Gene: ENSMPUG00000012530   Transcript: ENSMPUT00000012637
Sequence length 750
Comment pep:known scaffold:MusPutFur1.0:GL896993.1:3678224:3717779:-1 gene:ENSMPUG00000012530 transcript:ENSMPUT00000012637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIICNCLKEERRILENAQ
RFNQAQSGSIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLIQKMYLMLDNKRKEVVLKIIELLNVTELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGEPHFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
Download sequence
Identical sequences M3YM79
ENSMPUP00000012436 ENSMPUP00000012436 XP_012917317.1.14098 XP_012917318.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]