SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012471 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012471
Domain Number 1 Region: 549-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-82
Family Protein kinases, catalytic subunit 0.000000346
Further Details:      
 
Domain Number 2 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.02e-60
Family FCH domain 0.00082
Further Details:      
 
Domain Number 3 Region: 449-581
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-31
Family SH2 domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012471   Gene: ENSMPUG00000012565   Transcript: ENSMPUT00000012673
Sequence length 823
Comment pep:novel scaffold:MusPutFur1.0:GL896977.1:263037:710788:1 gene:ENSMPUG00000012565 transcript:ENSMPUT00000012673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSFVGVHQQ
IEAEMIKVTKTELEKLKSSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYNTTLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKAIAEELTQTQQMLLNKEEAVLELEKRIEESSKTCEKKSDIVLLLSQKQTL
EELKQSVQQLKCAEAKFTAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALGSSTFSDTIPISEKPLAEQDWYHGAIPRIEAQDLLKQQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQFVDNLYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWVLNHEDVTLGELLGKGNFGEVYKGILKDKTAVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPIYIIMELVPGGDFLSFLRKKKDEIKLKQ
LVKFSLDAASGMSYLESKNCIHRDLAARNCLVGENNILKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQHCPEDIFKIMTKCWDYKPENRPKFSELQKELTVIKRKITQ
Download sequence
Identical sequences M3YMB4
ENSMPUP00000012471 ENSMPUP00000012471 XP_004761356.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]