SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012726 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012726
Domain Number 1 Region: 267-381
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-31
Family Pleckstrin-homology domain (PH domain) 0.0000731
Further Details:      
 
Domain Number 2 Region: 524-626
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-24
Family SH2 domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.28e-22
Family Adapter protein APS, dimerisation domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012726   Gene: ENSMPUG00000012822   Transcript: ENSMPUT00000012931
Sequence length 757
Comment pep:novel scaffold:MusPutFur1.0:GL897085.1:1508304:1514034:1 gene:ENSMPUG00000012822 transcript:ENSMPUT00000012931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGSPSPEDGASPSPPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGVDIPPQDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGAVDPPS
PAGTLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGDRWTHRFERLRLSRGGGAL
KDGAGTVQREELLNFMGAEEAAPDPAGVGRGGGAAGPTSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSTITDVRTTTALEMPDRENTFVVKVEGPSEYVLETAD
ALHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELPCLNHSESLPS
QDLLLGASESNDRLSQGAYGGLADRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE
GPPAGTVHPLSAPYPPLDTPETAAGSFLFQGESEGGEGDQPLSGHPWFHGMLSRLKAAQL
VLAGGAGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVVSSQRQQEPNTSHDPPQPPEPPPWTDPPHPGAEEA
SGAPEVAAAAATAAKERQEKEKAGSGGVQEELVPVVELVPVVELEEAVAPGTAAEGGAGS
GGDPGAAPTVQLQQSPLGVGGDEGAHPRAVRNQYSFV
Download sequence
Identical sequences M3YN19
ENSMPUP00000012726 ENSMPUP00000012726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]