SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012765 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012765
Domain Number 1 Region: 307-428
Classification Level Classification E-value
Superfamily SH2 domain 9.29e-25
Family SH2 domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012765   Gene: ENSMPUG00000012863   Transcript: ENSMPUT00000012972
Sequence length 444
Comment pep:novel scaffold:MusPutFur1.0:GL897119.1:1322371:1367770:-1 gene:ENSMPUG00000012863 transcript:ENSMPUT00000012972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFQDSHQASFPLQFFYTSDFNNGNSKGIPIFTLSVSTTFLNSSAERSSENGKSVHWKLG
ADKEVWVWVMGEHHLDKPYDVLCNEIIAERAQLKAEREAEDLRKTQSKEFANNLKMKSQY
YDLQAPDTQETQNICKKAATEAEKLGKGSRPAPLLEEEKIASLSSSSRNIQQMLADSINR
MKAYGFHQKKEPEKKTQDEELKQIDEEKAKQIYKSWKEDSEWQASLSSARDKPSQEEKGR
NSAGSAGQDSQELREGVHRVQCLPAPLVHPPPTPPRGVNDLGNDFFSYGQKPKKNLRNQG
VRRTASNSAQEDIIRWFKEEQLPLRAGYQTTSDTIAPWFHGILTLKRANELLSTCEPGSF
LVRVSERIKGYALSYLSEDGCKHFLIDASTDSYSFLGVDRLQHATLAALVDYHKVEPITS
LGKELLLYPCGQQGEPPDYLELFE
Download sequence
Identical sequences M3YN58
ENSMPUP00000012765 ENSMPUP00000012765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]