SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012798 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012798
Domain Number 1 Region: 417-515
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-21
Family SH2 domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012798
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00691
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012798   Gene: ENSMPUG00000012897   Transcript: ENSMPUT00000013006
Sequence length 536
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:10454064:10496731:1 gene:ENSMPUG00000012897 transcript:ENSMPUT00000013006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNVPFRSDVLSWDPDSLADYFRKLNISSMESCLVPQFNTHHIRLLNNLTENDIQKFP
KLRVPILSKLSQEINKNEERRSIFTRKPQVQRFPEETESHEEDNGGWSSFEEDDYESPTD
DQNEDDNDDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSTYIADRP
PSSKAPQQPPVPPQRPMAGLPPPPAGRSHPPLPPPQPNHEEPSRSRNHKTAKLPAPSIDR
STKPPLDRSLAPFDREPFTLGKKPPFPDKPSAPAGRPLGEHLPKMQKPPLPPATERHDRG
TPLPGKKPPVPRHGWGQDRRENDEDDVHQRPLPQPTMPSMSSNTFPSRSTKPSPKHALPS
PHMPGAFSESNSGFPQSASLPPYFSQGLNHRPPPRAEGRNFSLPVPNKPRSLASGEEENS
LNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTITNPYVLMVLYKDKVYNIQIRYQ
EESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHSAGYP
Download sequence
Identical sequences M3YN91
ENSMPUP00000012798 ENSMPUP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]