SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012872 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012872
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 209-256
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000249
Family SOCS box-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012872   Gene: ENSMPUG00000012972   Transcript: ENSMPUT00000013081
Sequence length 257
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:218718:225146:1 gene:ENSMPUG00000012972 transcript:ENSMPUT00000013081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGPCSLLAVERIGQRPLWAQSLELPEPAMQPLPAGAFLEEVAEETPAQPESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADPRSDSPDPAP
TPAPPTPKEDVPGDPALPVPTVTAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMANYLRQYPFQL
Download sequence
Identical sequences M3YNG5
XP_004760604.1.14098 ENSMPUP00000012872 ENSMPUP00000012872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]