SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013386 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013386
Domain Number 1 Region: 352-613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.000000000361
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-44
Family Pleckstrin-homology domain (PH domain) 0.0000593
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-32
Family SH2 domain 0.00000156
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-17
Family SH3-domain 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013386   Gene: ENSMPUG00000013488   Transcript: ENSMPUT00000013601
Sequence length 620
Comment pep:known scaffold:MusPutFur1.0:GL896898.1:22150480:22215877:-1 gene:ENSMPUG00000013488 transcript:ENSMPUT00000013601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKTSLAYFENRQGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPMY
HPNFWMDGRWRCCAQQEKLAVGCAQYDPTKNASKKPLPPTPEDNRRSLQEPEETIVIALY
DYQTNDPQELMLQRNEEYYLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNSLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIHP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDITTGFRLYKPRLASANIYQIMNHCWKEKPE
DRPPFCRLLSQLAEIAESGL
Download sequence
Identical sequences M3YPX8
XP_004737785.1.14098 ENSMPUP00000013386 ENSMPUP00000013386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]