SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013582 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013582
Domain Number 1 Region: 203-320
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 565-721
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-21
Family Ras GEF 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013582   Gene: ENSMPUG00000013685   Transcript: ENSMPUT00000013799
Sequence length 857
Comment pep:known scaffold:MusPutFur1.0:GL896954.1:6775057:6803628:1 gene:ENSMPUG00000013685 transcript:ENSMPUT00000013799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGPKKASRKFKFFKFKGLGSLSNLPRSFTLKRSSTTLSLGSHLEPDPFEATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRLSTRKARDQQATQETKEVDQPHLAPQGLPNPPGLEATK
EMVVGTSVPLEDTLAVGPNPSAMGPTEKPEDLRADGKEERGPRNVPPERVAGEPEAGGDY
VKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIR
DSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYHVGS
RKAVSEQSGAIIYCPVNRTFPLRYLEACYGLGQGSGKAASPASPSGPKGSHMKRRSVTMT
DGLTADKVTRSDGCPTSTSLPHPRESIRNCALSMDQIPDLHSPMSPISESPSSPAYSTVT
RVHATPTAPSATVLPASPVTRRSSEPQLCPGSAPKPPGESDKGPYASPSHTLSKASPSPS
LSSYSDPDSGHYCQLQPPVRGSREWAAAEASSRQARSYGERLKELSENGAPEGDWGRAFI
APVVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLVAR
ILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEERAV
LLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWVTLRQRHTEGAILYEKKLK
PFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHLEAA
RTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSNQARRYEKFDKV
LTALSHKLEPAVRSSEL
Download sequence
Identical sequences M3YQH3
XP_004757311.1.14098 ENSMPUP00000013582 ENSMPUP00000013582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]