SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013599 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013599
Domain Number 1 Region: 10-120,161-187
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 61-79,135-227
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-25
Family SH3-domain 0.0000291
Further Details:      
 
Domain Number 3 Region: 209-300
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013599   Gene: ENSMPUG00000013702   Transcript: ENSMPUT00000013816
Sequence length 304
Comment pep:novel scaffold:MusPutFur1.0:GL896917.1:1634930:1660762:1 gene:ENSMPUG00000013702 transcript:ENSMPUT00000013816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPSVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
Download sequence
Identical sequences M3YQJ0
ENSMPUP00000013599 9615.ENSCAFP00000028257 ENSMPUP00000013599 XP_003435250.1.84170 XP_004746942.1.14098 XP_021559815.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]