SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013831 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013831
Domain Number 1 Region: 308-539
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000218
Further Details:      
 
Domain Number 2 Region: 172-288
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-28
Family SH2 domain 0.0000136
Further Details:      
 
Domain Number 3 Region: 60-167
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-25
Family SH2 domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013831   Gene: ENSMPUG00000013936   Transcript: ENSMPUT00000014051
Sequence length 542
Comment pep:novel scaffold:MusPutFur1.0:GL897284.1:158165:169717:1 gene:ENSMPUG00000013936 transcript:ENSMPUT00000014051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWQGSDFEASFLVAAVWGCWTASVPLTPTTPNPSDVSAHLCPWDPVAPLLPHSPQSQPV
AIARGRLWFHPNISGVEAEKLLLSRGQHGSFLVRPSKSCRGSFTLSVRRHNEVAHINVQN
TGDYYDLYGGEKFATLAELVHHYTGQRGGLLREHSGAPVELQQPLGYQNPVSERWYHGHL
SGKEAEQLLMEKGRLGTFLVQESRSHPGDFMLSVLTPRPEKADLQPRVTHTMIHFQPDGK
YDVGGGVQFDSLTDLVEHCRKNPMVKKSGTVVQLKQPLKATRINAASIESRVQELSGPTD
ASGKAKQGFWEEFEMLQQQGCRLLYPRKEGQRLENLPKNRYKNILPFDTTRVTLRDADDT
VPGADYINANYVRSDPEKTAHGPGKVYIATQGCLQSTVAAFWAMVHQENTRVIVMATREV
ERGRNKCFWYWPELQGSQEYGRVRISNLAEYQAQDYCVRELQVWRPDQEEPRRTVKHYQY
FSWPDHGVPAEPSGVLGFLDEVNRAQSSMPGAGPVVVHCSAGIGRTGTIIVIDVLVDLIR
RR
Download sequence
Identical sequences M3YR72
ENSMPUP00000013831 ENSMPUP00000013831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]