SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013872 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013872
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000445
Further Details:      
 
Domain Number 2 Region: 14-149
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.000000335
Further Details:      
 
Domain Number 3 Region: 197-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013872   Gene: ENSMPUG00000013977   Transcript: ENSMPUT00000014092
Sequence length 459
Comment pep:novel scaffold:MusPutFur1.0:GL897095.1:1010291:1224812:-1 gene:ENSMPUG00000013977 transcript:ENSMPUT00000014092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTNEVENRPKYYGREFHGMISREEAD
QLLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDG
LITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAYQKHMPVLKETHDERDSTGQDGVS
EKRLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNSE
GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAY
PKFIESAKIMDPDEQLEALHEALRLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences M3YRB3
ENSMPUP00000013872 ENSMPUP00000013872 XP_004774438.1.14098 XP_012902273.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]