SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014103 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014103
Domain Number 1 Region: 16-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014103   Gene: ENSMPUG00000014212   Transcript: ENSMPUT00000014328
Sequence length 1024
Comment pep:novel scaffold:MusPutFur1.0:GL897121.1:2540043:2554467:-1 gene:ENSMPUG00000014212 transcript:ENSMPUT00000014328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRQKGKKKGSSKERVFGCDLQEQLQRSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVS
SNIQKLRQEFEAERKPDLRKDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFADAVGV
QLEPERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRS
KDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALSGGEMESGWRSLPGARASAS
PEDLMPRSLPCHLPSILQAGDGPPQMRPYHTIIELAEHKRKGSLKVRKWRSIFNLGRSGH
ETKRKLPRGAEDREDKSDKGTLRPAKSMDSLSAAAGASDEPEVLVGPGSPRPSPLLPDSL
ENDSAEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGCSRAERCVGVHISDPYNVNL
PLHITSILNVPPNIISNVSLARLTRGLECPALQPRPSPASGPGPGPGPGPPDEKLEASSA
TGPLADSGPEDMAPALEDCLSQEVQDSFSFLEDSSSSEPEWVGVEDGEVAQAGAAGAAFS
PGEDDPGMGYLEELLRVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSPDSAAPRPEGEE
ESGEEVFLSAYDDLSPLLMPKPPTWQGSRSPEEETAGCGRQEAPGQAEGEDACCKGGEAK
EADPENTWALREEAEGSPESEGDDGETGEEGGKAAESQEMMVSLREGSGKETEAKGEESK
SQQENESMKEAQDVEGTEGELSKGNETERKTEREEEAQEGQEGQVRARSDPECGVQENQV
AEESWEVVHKQEAEEAREDEVKGQEGQKDQEVREDRGDGEDRRSPEAAAGGGGGEVSMDR
ESGDGESEGDQRAGGDHLGKDSPPEGSHAESLETDSAKGGNSQSSEATPQPPQLEEMEPE
GQPSPEGCNLCPCPLGSPSGVGMRLASSLVQVQQIRSVPVVPPKPQFAKMPSAMCSKIHV
APANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQ
NLPL
Download sequence
Identical sequences M3YRZ3
ENSMPUP00000014103 ENSMPUP00000014103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]