SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014319 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014319
Domain Number 1 Region: 1186-1526
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-86
Family p120GAP domain-like 0.0000000000204
Further Details:      
 
Domain Number 2 Region: 197-380,870-904,932-1202,1838-1942,2019-2034,2197-2261,2602-2614
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000397
Family Armadillo repeat 0.038
Further Details:      
 
Domain Number 3 Region: 1830-1858,1894-2137,2184-2285,2359-2424,2584-2660
Classification Level Classification E-value
Superfamily ARM repeat 0.000000792
Family Clathrin adaptor core protein 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014319
Domain Number - Region: 1561-1700
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00051
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014319   Gene: ENSMPUG00000014426   Transcript: ENSMPUT00000014547
Sequence length 2815
Comment pep:known scaffold:MusPutFur1.0:GL896917.1:5490267:5694059:1 gene:ENSMPUG00000014426 transcript:ENSMPUT00000014547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLY
LSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASG
VLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKETAFK
FKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAEST
KRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESA
AIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMIDCL
VSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSALDWWPKIDAVYCHSVELR
NMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEKPTDLETRSYKYLLLSMVKLI
HADPKLLLCNKRQLTRETKGERDTEFLKGLVMPNLTSETMKALLVLHQLDSIDLWNPDAP
VETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHFLF
LYGVGCDVPSSGTTGQMSMNHEELLPSCTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQ
TKLEVALYMFLWSPDTEAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASV
SNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQA
AESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYS
PPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLE
LNPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLG
QASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEY
LTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFL
KYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHS
IGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIA
MALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKI
MTFCFKVYGANYLQKLLDPLLRIVITSSDWQHVSFEVDPTSRLEQSESLEENQRNLLQMT
EKFFHAIISSSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSIG
AVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRP
FNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLS
SNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEE
FKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVV
DLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYHCNSWVREYTKYHERLLTGLKGS
KRLIFIDGPGKLAEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQ
VTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQS
IIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCT
FNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKH
LCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQI
TDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCL
SPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTH
GLVINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYR
DRSFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPS
LQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQP
LLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAI
RNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKH
RNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPVHHGDP
SYRTLKENQPWSSPKGSEGYLAATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKS
FDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQHPHLRKVSVSESNVL
LDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSK
INTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQI
PDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPAVQSQLSITANLNLSNSMTS
LATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Download sequence
Identical sequences M3YSK9
ENSMPUP00000014319 ENSMPUP00000014319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]