SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014567 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014567
Domain Number 1 Region: 566-706
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-46
Family Phosphotyrosine-binding domain (PTB) 0.0000159
Further Details:      
 
Domain Number 2 Region: 412-553
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-21
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014567   Gene: ENSMPUG00000014676   Transcript: ENSMPUT00000014800
Sequence length 711
Comment pep:known scaffold:MusPutFur1.0:GL897006.1:537365:558071:1 gene:ENSMPUG00000014676 transcript:ENSMPUT00000014800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVMSSALLAGGHAVGLTPCEEPRRTLHPAPSPGLPPQCPYYTTEGWGAQGLMASTPFK
GPPSRLQQGPETGAKASRLLQSPAEQTSGTLEDLNSYIDFSLESLNQMILELDPTFQLLP
PGTGSPWTEPTQSTTSRKKKDDAEALDIKYIEVSSTRSRGPDGPQCCSNPSATPPFGSPR
SGGLLLSRDIPRETRSSSESLIFSGSQGRGHQRTPPPSGAPSSHPSPSPSISIPCMRSKA
SGSHGLGSPLAASPGLEKGLAPQRGSRISVLSASPVSDGSYVFGSSQSLIHSSVSSHQSS
SRSLESPASSSSSLHSLGQVSLCTRASDSQVPGNPTPNMGQPRTTHSPPAAKEHASSCPP
SITNSMVDIPIVLINGCPEPGSPPTQQIPGYQDFVRPGATSSSNSCPATRSHSQTLPDAS
LTTPSEGPTRDMQPTMKFVMDTSKYWFKPSITREQAIELLRKEEPGAFVVRDSSSYRGSF
GLALKVQEAAAPAANRSGEDNSDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQHSI
MALALPCKLTIPQKELGGGVSSDTTDSRASCLKKSAGCHALYLTSVSVETLSGALAVRKA
ISTTFERDVLPTPTVVHFKVTDQGITLTDVQRKVFFRRHYPLTTLRFCGMDPEQRKWQKY
CKPSWIFGFVAKSQTESQENVCHLFAEYDPVQPASQVISLVRTLLQDTERM
Download sequence
Identical sequences M3YTA7
XP_004764647.1.14098 ENSMPUP00000014567 ENSMPUP00000014567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]