SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014860 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014860
Domain Number 1 Region: 418-526
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-31
Family SH2 domain 0.000000658
Further Details:      
 
Domain Number 2 Region: 96-191
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-30
Family Ras-binding domain, RBD 0.00000622
Further Details:      
 
Domain Number 3 Region: 229-342
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000142
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014860   Gene: ENSMPUG00000014970   Transcript: ENSMPUT00000015096
Sequence length 529
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:1130195:1135082:-1 gene:ENSMPUG00000014970 transcript:ENSMPUT00000015096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSPPQLSSSPEDLYLAPGTPPGTPPPPDAPLPGEVKRSQPLPIPTRNLLREEELRT
SSLPSIPNPFPELCSPPSQTPILGGSSSARGLPPRDTSCPHVVKVYSEDGACRSVEVAAG
ATARYVCEMLVQRARALSDENWGLVECHPHLALERGLEDHESVVEVQAAWPIGGDSRFVF
RKNFAKYELFKSSPHTLFPKKMVSSCVDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRGS
GRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYIADVNESNVYVVTQGRKLYGMPTDFGF
CIKPNKLRNGHKGLRVFCSEDEQSRGCWLAAFRLFKYGAQLYKNYQQAQSRHLRPSCVGS
PPLRSVSDNTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKNHRLSLPTPGSGTSLSA
AIHRTQPWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLIL
PSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCVLRHCCTRVAL
Download sequence
Identical sequences M3YU50
XP_012918113.1.14098 ENSMPUP00000014860 ENSMPUP00000014860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]