SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015082 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015082
Domain Number 1 Region: 325-446
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 450-489
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000876
Family SOCS box-like 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015082
Domain Number - Region: 123-134
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015082   Gene: ENSMPUG00000015192   Transcript: ENSMPUT00000015320
Sequence length 516
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:2148657:2178235:-1 gene:ENSMPUG00000015192 transcript:ENSMPUT00000015320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGLGQPAGPGVKTVGGGCCPCPCPCPPQPPPPQPQPPAVAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPAPFPMQDLVPPGRLGRGEP
QQPPPPPPPPGPLRPLAGPSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKRPSGELAASA
ASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHP
PTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRMAPIRAA
ESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVR
DSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNG
KFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLI
SYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
Download sequence
Identical sequences M3YUS2
ENSMPUP00000015082 ENSMPUP00000015082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]