SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015151 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015151
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-81
Family Protein kinases, catalytic subunit 0.000000000205
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-39
Family SH2 domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 54-172
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-23
Family SH3-domain 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015151   Gene: ENSMPUG00000015261   Transcript: ENSMPUT00000015390
Sequence length 509
Comment pep:known scaffold:MusPutFur1.0:GL896903.1:15463381:15488326:-1 gene:ENSMPUG00000015261 transcript:ENSMPUT00000015390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNSEEDWMENIDVCENCHYPIVPLDGKATLPIRNGSEVRDPLVIYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILERNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDQGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPPGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIVDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences M3YUZ1
XP_004740975.1.14098 ENSMPUP00000015151 ENSMPUP00000015151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]