SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015520 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015520
Domain Number 1 Region: 940-1067,1099-1305
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-79
Family p120GAP domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-39
Family Calponin-homology domain, CH-domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 1530-1627
Classification Level Classification E-value
Superfamily RGC domain-like 1.31e-32
Family RGC domain 0.00000189
Further Details:      
 
Domain Number 4 Region: 602-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000114
Family Nucleotide and nucleoside kinases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015520   Gene: ENSMPUG00000015630   Transcript: ENSMPUT00000015761
Sequence length 1627
Comment pep:novel scaffold:MusPutFur1.0:GL896996.1:4179594:4282046:1 gene:ENSMPUG00000015630 transcript:ENSMPUT00000015761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVV
SLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMHEIGLPKIFYPETTDIYDRKNMPRCIY
CIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAFSKIGGILANEL
SVDEAALHAAVIAINEAVDRRIAADTFVALRNPNAMLVNLEEPLASTYQDVLYRAKQEKM
TNAKNRTENSERERDVYEELLTQAEIQGNINKVNTSSALANVDLALEQGVALALFKALQS
PALGLRGLQQQNGDWYLKQLLSDREQKRQGGQADPLQKEELQCGVDAANGAAQQYQRRLA
AVAAINAAIQKGVAEKTVLELTNPEAQLPQVYPFAADLYQKELATLQQQSPEHSLTHPEL
SVAVEMLSSVALINRALESGDMNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKTQAHA
ENTAFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEG
VLAEVAQHYQDTLIRAKREKAQETRDESAVLWLDEIQGGIWQSNKDTQEAQRFALGIYAI
NEAVDSGDVGKTLSALRSPDVGLYGVIPECGETYQSDLAEAKKKKLAAGDNNSKWVKHWV
KGGYYYYHNLETQEGGWEEPPDFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLIT
RLQARCRGYLVRKEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRAHKDEVV
KIQSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYKTLINAEDPPMIVVR
KFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIKIGLLVKNKITLQDV
VSHSKKLTKKNKEQLSDMMMLNKQKGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLI
FQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPT
VIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEAS
KLPYDVTPEQALAHEEVKTRLDNSIRNMRAVTDKFLSAIISSVDKIPYGMRFIAKVLKDS
LHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAK
MLQHAASNKMFLGDNAHLGIINEYLSQSYQKFRRFFQTACDVPELQDKFNVDEYSDLVTL
TKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGESAGNLND
PNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPGETLTEILET
PATSEQEAEHQRAMQRRAIRDAKTPDKMKKSKFVKEDSNLTLQEKKEKIQSGLKKLTELG
TVDPKNRYQELINDIAKDIRNQRRYRQRRKAELVKLQQTYAALNSKATFYGEQVDYYKSY
IKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIF
EISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFNRAKVNVNLLIFLL
NKKFYGK
Download sequence
Identical sequences M3YW10
ENSMPUP00000015520 ENSMPUP00000015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]