SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015552 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015552
Domain Number 1 Region: 547-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-81
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 12-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.71e-52
Family FCH domain 0.016
Further Details:      
 
Domain Number 3 Region: 438-576
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-28
Family SH2 domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015552   Gene: ENSMPUG00000015662   Transcript: ENSMPUT00000015793
Sequence length 820
Comment pep:novel scaffold:MusPutFur1.0:GL896996.1:4593273:4601805:1 gene:ENSMPUG00000015662 transcript:ENSMPUT00000015793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSAQGHGALQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGRG
MSPNSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLGLLIRERQQLRKTYSEQWQQ
LQQDLTKAHSQDIEKLKSQYRVLARDSAQARRKYQEASKDKDRDKAKDKYVRSLWKLFAH
HNRYVLGVRAAQLHHQHHHQLLLPGLLQSLQDLHQEMACILKEILQEYLEISSLVQDEVA
AIHLEMAAAVARIQPETEYQGFLRQYGSTPDIPPCVTFDESLLEEGELLAAGELQLNELT
VESVQHTLTSVTDELAAATETVLSRQEAVTQLQRDLWNEEQNTHPRERVQLLAKKQVLQE
ALQGLQVALCSQAKLQAQQELLQAKLEQLGPGEPPPVLLLQDDRHSTSSSEQEREGGRTP
TLEILKSHISGIFRPKFSLPPPLQLVPEVQKPLHEQLWYHGAIPRAEVAELLTHSGDFLV
RESQGKQEYVLSVLWDGQPRHFIIQSTDNLYRLEGDGFPSIPLLIDHLLRSQQPLTKKSG
IVLNRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKA
KFLQEARILKQYNHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGSRLRMKTLLQ
MVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGIYAASGGLRQV
PVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGAPPYPNLSNQQTREFVEKGGRLPCP
ELCPDAVFRLMEQCWAYEPAERPGFSAISQELQSIRKRHR
Download sequence
Identical sequences M3YW42
ENSMPUP00000015552 ENSMPUP00000015552 XP_012917452.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]