SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015855 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015855
Domain Number 1 Region: 144-675,806-1000
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.08e-262
Family Motor proteins 0.00000000169
Further Details:      
 
Domain Number 2 Region: 1695-1884
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000879
Further Details:      
 
Domain Number 3 Region: 1626-1684
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000297
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000162
Family Ras-binding domain, RBD 0.034
Further Details:      
 
Domain Number 5 Region: 998-1050
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000531
Family Motor proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015855   Gene: ENSMPUG00000015959   Transcript: ENSMPUT00000016096
Sequence length 2161
Comment pep:known scaffold:MusPutFur1.0:GL896974.1:6872093:6937356:-1 gene:ENSMPUG00000015959 transcript:ENSMPUT00000016096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNEAGSSGRAGQAAYHLRIYPQLATSESRASCRVTATKDSTTSDVIQDAVAILQLDGT
KCYVLVEVKETGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VQMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEENLLKNLRHRFLQQKIYTYAG
SILVAVNPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYAMLRKQVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFSVLSAILYLGNVTYKKRA
TGRDEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTANDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDMEESVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQSEGISWHNIDYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNRYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAAGMGSPG
THGPPAELQRGTSTPSEKLYRDLHDQIIKTIKGLPWQGEDPRRLLQSLSRLQKPRTFILK
SKGIKQKQLIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLL
EALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFT
EQFQVLLPKNAPPCREVISALLEKMDVDKRNYQIGKTKVFLKETERQALQETLHREVVRK
ILLLQSWFRGVLERRHFLQMRQAAITIQACWRSYRVRRALERTQAAIYLQAAWRGYQQRV
AYRRRRQSIIRLQSLCRGHLQRKSFSQMMAEKQRAGEDRAAQQTLRAETAEGGPGQAAQP
EQVPRQDPEPSEDREHSTSEPEAWPSEEPLVESSQPEMEVPSPEKPLPPQKNTADSHEKV
PSSREKRESRRQRGLEHVKLQNKHIQSCKEELALREPSGRTVLEQEESLPEDRKNREDET
PSDLGTETENASKKQPEEPPQATPTSELSGETPKMLQGEHPEPGPVARPTSLALDSRVSM
PAPVTTPETPKDKRKPGGDPRALDRSESPGGSTQIQRYRDPDSERLANAVELWRGRKLPP
TCPSAMLSQSLDLSERHRAVGAALTPTEERRISLSTSDVSKLLPSPSQTKMQPSIEAVDG
EPSTKKPAVQKKKSGDASVGTDSGLSPGPPADSKSTFKRLFLHKNKDKKSSLEGVEEMEN
TAPGHTAPEATTTKKNLEASFSHQHRHPAGEKHAKEPGGKGKKNRNLKIGKITVSEKWRE
SVFRKITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNLKTMYSVPNGKIH
VGYKDLMENYQIVVNNLAAERGEKDTNLVLNLFQSLLDEFTRGHTKNDFEPPKQSKAQKK
KRKQDRAVQQHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQT
YCSYTCGSKSEPGAEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGA
ANRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPE
KQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPSALAIIFAPCLLRCPD
NSDPLTSMKDVLKVTTCVEMLIKEQMRKYKVKMEEINQLEAAESIAFRRLSLLRQNAPWP
LKLGFSSPYEGVLNKSPKARASSGGGPEELGVLPEEEVPGGDEDREKEILIERIQSIKEE
KEDITYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPVLPSPGAPALSP
LPVAAAPPRRRPSSFVTVRVKTPRRTPIMPTTNIKLPPGLPSHLPGRAPGAPEAAAPVRR
REPPARRPDQVHSVYVTPSTLLPVLGTREPPDEDDRPPGAKRRYSDPPTYCLPPTSGQAN
G
Download sequence
Identical sequences M3YWZ5
ENSMPUP00000015855 ENSMPUP00000015855 XP_012916005.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]