SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015986 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015986
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-27
Family Phosphotyrosine-binding domain (PTB) 0.0094
Further Details:      
 
Domain Number 2 Region: 272-390
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000664
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015986   Gene: ENSMPUG00000016093   Transcript: ENSMPUT00000016230
Sequence length 428
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:24763525:24776430:1 gene:ENSMPUG00000016093 transcript:ENSMPUT00000016230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAGAGGRRASDCGPVPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPQSPANKLFC
HLFVGNQPGEVQILHLLLCRSFQLAYLLQHPEQRAQPEPCLGSAGDIAPKQLSSPGGPPG
LVREPFGRGQLSQNVHALVSFRRLPAEGPMGSGKELPESEGRGGARHARLGNPYCSPTLV
RKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGPSCLVESEGSLTENI
WAFAGISRPSALALLRRDVLGAFLLWPEPGTSGQWCLSVRTQCGVVPHQVFRNHLGRYCV
EHLPAEFASLEALLEHHAGTERSLFCSLDMGRLNPGYEEQDCGSEGRPPRTLRPLSHAKS
EAELQGLG
Download sequence
Identical sequences M3YXC6
ENSMPUP00000015986 ENSMPUP00000015986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]