SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016402 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016402
Domain Number 1 Region: 1699-1842
Classification Level Classification E-value
Superfamily PH domain-like 8.06e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000524
Further Details:      
 
Domain Number 2 Region: 304-431
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.92e-40
Family PLC-like (P variant) 0.0026
Further Details:      
 
Domain Number 3 Region: 138-302
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-31
Family Dual specificity phosphatase-like 0.00012
Further Details:      
 
Domain Number 4 Region: 1547-1689
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-22
Family SH2 domain 0.0022
Further Details:      
 
Domain Number 5 Region: 16-70
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016402   Gene: ENSMPUG00000016505   Transcript: ENSMPUT00000016647
Sequence length 1873
Comment pep:novel scaffold:MusPutFur1.0:GL896989.1:1594558:1788324:-1 gene:ENSMPUG00000016505 transcript:ENSMPUT00000016647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWICLSCMLWPEDLEAPKTHHFKVKTFKKVKPCGICRQVITREGCTCKVCSFSCHRKCQ
AKVAAPCIPPSSRELVPINTESAPKNVADTGEGAFRGGNTRKSLEEDGSARVTLSVQPHP
QPIRNMSVSRATEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGSY
LLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKG
NRGRIGVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSG
SIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNVQGDSQTSICIT
IEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFP
EYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFDGHREDGMEEVVG
HTQGPLDGSLYAKVKKKDSLHGSTGAVNAVRPALSATPNHVEHTLSVSSDSGNSTASTKT
DKTDEPAPGPTSAPAALSPEEKRELDRLLSGFGVEREKPAPMYHTQHLRSRPAGGPAAPA
AGRHIVPAQVHVNGGALASERETDILDDELPNQDGHSVGSMGTLSSLDGVTNTSEGGYPE
ALSSLTNGLDKSYPAEPMVNGGGYPYESASRVAPAHVSHPAPVRPSYSAQEGLAGYQREG
PHPAWPQPVTTSHYGLDPSGMFRSQSFPESEPQLPPAPARSGSSREAVQRGLNSWQQQQQ
QQQQQQQQQQQPRPPPRQQERAHLESLGHSRPSPQPLAETPTPGLPEFPRAASQQEIEQS
IEALNMLMLDLEPAAAAAPLHKSQSVPGAWPGVSPLSSQPLAGSPCQPHPLTQSRSGYIP
SGPSLGTPEPAPRSSLALESFPSGRPYSPYDYQPCPAGSSQSFRPKSPASSSSSTFLPTT
QSPPGPQQPPASLSGLPAQPQFPPKEATSDPSRTPDEEPLNLEGLVAHRVAGVQAREKQP
AEPPAPLRRRAASDGQYENQSPEPASPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHL
HSYKEAFEEMEGTSPTSPPSSGVRSPPGLAKTPLSALGLKPHNPADILLHPTGEPRSYVE
SVVRTAVAGPRAQDPEPKSFSAPAAQAYGHETPLRNGTLGGSFVSPSPLSTSSPILSADS
TSVGSFPSGESSDQGPRTPTQTLLDSGFRPGSLGQPSPSAQRNYQSSSPLPPAGSSYGGP
DYSLQQFGSPEGQARSQFTVAGVHTVPGSPQASHRTVGTNTPPSPGFGRRAINPSLAAPG
SPSLSHRQVMGPAGTGLHGSTVSSPQGSAATTPGSPSLGRHPGAHQVPGLHGGVATTPGS
PSLGRHPGAHQSSLAPGLHGNMIASPGSPSMGRHMGGSGSVVPGSPSLDRHVAYGGHSTP
EDPRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEK
RRMSVGDRAGSLPNYATVNGKVSSSPVASGMSSPSRGSTVSFSHTLPDFSKYSMPDNSPE
TRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPP
TIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKL
VIPNRDPTDESKASSGSANSTTDLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAA
DPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGVPAK
LFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKNKCKRFFASASRPPRPLQERQK
NPASSRPPGCVFI
Download sequence
Identical sequences M3YYJ2
ENSMPUP00000016402 ENSMPUP00000016402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]