SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016511 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016511
Domain Number 1 Region: 425-545
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 548-586
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000123
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016511   Gene: ENSMPUG00000016614   Transcript: ENSMPUT00000016757
Sequence length 586
Comment pep:known scaffold:MusPutFur1.0:GL896913.1:12949115:12988498:1 gene:ENSMPUG00000016614 transcript:ENSMPUT00000016757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSVQQTFPEGDGSGGSARPGEAVDAASRPPRRRAERFAASGGAWCGQRVTMKKISLKTF
RKSFNLSKSKDETDFMVVPQPALAGDFGKDEPLFGGCYGKELAGCDLSGDGEQGGKGRSK
SESLMGTLKRRLSAKQKQKGKGGAAAGGSADDDTFSSSSAPLVFKDVRAQRPIRSTSLRS
HHYSPTPWPLRPTNSEETCIKMEVRVKALVHTSSPSPALNGVRKDFHDLQSETVCPEQSS
SLKGSESQHGDLHLHLEDHVPVVIGLVPQDYIQYTVPLDEGMYPLEGPRGYCLDTSSPME
VSAVPPQVGGGSFAEDENQVDQDLVVAPEIFVDQAVNGLLIGTTGVMLQSPRAGHDDAPP
LSPLLPPMQTNPVQRNFGALAGTDAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVV
TSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTL
HTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTN
PVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences M3YYV1
ENSMPUP00000016511 XP_004745686.1.14098 ENSMPUP00000016511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]