SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016662 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016662
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000139
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 93-213
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-26
Family SH2 domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016662   Gene: ENSMPUG00000016767   Transcript: ENSMPUT00000016911
Sequence length 595
Comment pep:known scaffold:MusPutFur1.0:GL897020.1:4961814:4978241:-1 gene:ENSMPUG00000016767 transcript:ENSMPUT00000016911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
EALLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYVKNQLLGPDENTKTYIASQGCLEATVNDFWQMVWQENTRVIVMTTREVEKGRNK
CVPYWPEVGTQRVYGPYVVTNCREHDTAEYKLRTLHVSPLENGDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGRESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHSKNKKEEKVKKQRSADKEKSKGSLKRK
Download sequence
Identical sequences M3YZA2
ENSMPUP00000016662 ENSMPUP00000016662 XP_004766691.1.14098 XP_012919060.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]