SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016759 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016759
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.59e-51
Family G proteins 0.0000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016759   Gene: ENSMPUG00000016864   Transcript: ENSMPUT00000017008
Sequence length 182
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:2922430:2959156:1 gene:ENSMPUG00000016864 transcript:ENSMPUT00000017008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG
FKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP
VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK
KK
Download sequence
Identical sequences A0A1S3FAM9 A0A2K5KAJ4 A0A2K6KWM3 A0A2K6P8X4 F6SUZ3 I3MMY5 M3YZJ9 Q52NJ4
ENSMPUP00000016759 NP_001026955.1.46622 XP_002756607.1.60252 XP_002913935.1.58354 XP_003409196.1.64505 XP_003994415.1.62641 XP_004268571.1.21590 XP_004402039.1.74151 XP_004478903.1.11602 XP_004631545.1.9945 XP_004680537.1.23501 XP_004749423.1.14098 XP_005333672.1.77405 XP_005403886.1.28644 XP_006210522.1.17985 XP_006731124.1.47382 XP_006831362.1.41390 XP_007126963.1.24612 XP_007126964.1.24612 XP_007187303.1.59432 XP_007470475.1.90284 XP_008708777.1.72690 XP_010331427.1.74449 XP_010354480.1.97406 XP_010985440.1.51371 XP_011812764.1.43180 XP_012873315.1.60039 XP_014918557.1.86478 XP_015350218.1.40921 XP_017707178.1.44346 XP_019314827.1.44245 XP_019669324.1.62641 XP_019795471.1.83887 ENSCJAP00000033382 ENSPCAP00000009177 ENSMPUP00000016759 ENSPCAP00000009177 ENSCJAP00000033382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]