SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016942 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016942
Domain Number 1 Region: 109-308
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016942   Gene: ENSMPUG00000017048   Transcript: ENSMPUT00000017193
Sequence length 494
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:7529741:7595751:1 gene:ENSMPUG00000017048 transcript:ENSMPUT00000017193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEAQGEGEVPASDSRPSDAICNFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEVFTEL
VVSNITRLIDLPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVVFGSPLTEE
GIAQIYQLIEYLHKNLRVEGLFRVPGNSVRQQILRDALNNGTDIDLESGEFHSNDVATLL
KMFLGELPEPLLTHKHFHAHLKIADLMQFDDKGNKTNVPDKERQIEALQLLFLILPPPNR
NLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKNVTANDLQENITKLNNGMAFM
IKHSQKLFKAPVYIRECARLHYLGSRTQASKDDLDLIASCPTKSFQLTKSQKRNWVDSCS
HQEETQQRTEEALRELFQHVHNMPESAKKKQLIRQFNKQSVTQTPGRESSTPQVQKRARS
RSFSGLIKRKVLGNQMMSEKKNKYPTPESVAIGEMKRASKENMNLLFSGSPAVTMTPTRL
KWPEGKKEGKKGFL
Download sequence
Identical sequences M3Z031
XP_004749632.1.14098 ENSMPUP00000016942 ENSMPUP00000016942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]