SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017009 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017009
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017009   Gene: ENSMPUG00000017118   Transcript: ENSMPUT00000017263
Sequence length 479
Comment pep:novel scaffold:MusPutFur1.0:GL896963.1:3479214:3528004:-1 gene:ENSMPUG00000017118 transcript:ENSMPUT00000017263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMT
FELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEETNRMSAN
ALAIVFAPCILRCPDTIDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENK
AKTRLSLIRRSMKPVLIAVRFMSITRSSVSGKGRLRRGNYPSPSSPVVVRLPSMSDVPEE
TLTSEATVETDITEQQQAAMQQEERVLTEQIENLQKEKEELTFEMLVLEPRASDDETLES
EASIGTADSSENLNIESEGAISEKSERSLVLSSLKAAGKSEPSSKLRKQLKRQQDSLDSV
DSSFSALCSSNTASSHGTRKRFQIYSKSPFYRAASAGEALGVEGPFGQTKSLEDRPQFIS
RGTFNPEKGKQKLKNVKNSPQKTKETPEGTVVTGRRKTVDPDSSSTQQLALFGNNEFMV
Download sequence
Identical sequences M3Z098
ENSMPUP00000017009 ENSMPUP00000017009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]