SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017191 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017191
Domain Number 1 Region: 182-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-76
Family Protein kinases, catalytic subunit 0.000000000303
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 9.69e-35
Family SH2 domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 11-102
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017191   Gene: ENSMPUG00000017301   Transcript: ENSMPUT00000017447
Sequence length 450
Comment pep:novel scaffold:MusPutFur1.0:GL896963.1:6034493:6057511:1 gene:ENSMPUG00000017301 transcript:ENSMPUT00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVILEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAATRPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences M3Z0S9
ENSMPUP00000017191 XP_004758487.1.14098 ENSMPUP00000017191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]