SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017314 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017314
Domain Number 1 Region: 220-559
Classification Level Classification E-value
Superfamily DNase I-like 3.89e-78
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000154
Further Details:      
 
Domain Number 2 Region: 677-693,731-893
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017314   Gene: ENSMPUG00000017424   Transcript: ENSMPUT00000017570
Sequence length 900
Comment pep:novel scaffold:MusPutFur1.0:GL897257.1:148474:202458:1 gene:ENSMPUG00000017424 transcript:ENSMPUT00000017570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRLPVGAQPLATIEGMEMKGTLREPRALTLARRNGQYELIIQLREKEQHVQDIIPINS
HFRCVQEAEETLLIDIASNSGCKIRIQGDRTRERRFEIPDEEHCLKFLSEVFAAQEAQSQ
LLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNHPTGIHREPPPP
PPSVNRMLPRDKEASNKEQPKVTNTMRKLFVPNTQAGQREGLIKHILAKREKEYVNIQNF
RFFVGTWNVNGQSPDSELEPWLNCDSNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMA
VERGLHSKAKYKKVQLVRLVGMMLLIFARKDQWRYIRDVATETVGTGIMGKMGNKGGVAV
RFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHDVVIWL
GDLNYRLCMPDANEVKSLINKNDLQRLLKFDQLNIQRTQKKAFADFTEGEIKFIPTYKYD
SKTDRWDSSGKCRVPAWCDRILWRGTNVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDE
RRYRKVFEDIVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFS
FIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLH
LDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSVLQM
VPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETI
PGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAQDPQNCRQVISQLPRCHRNVFHYLM
AFLRELLKFSKYNNVSENMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLESDED
Download sequence
Identical sequences M3Z152
ENSMPUP00000017314 ENSMPUP00000017314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]