SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017588 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017588
Domain Number 1 Region: 321-486,892-1071
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.88e-125
Family Mammalian PLC 0.00000689
Further Details:      
 
Domain Number 2 Region: 644-757
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 545-660
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-27
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1090-1212
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.93e-25
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 5 Region: 790-851
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-20
Family SH3-domain 0.0000295
Further Details:      
 
Domain Number 6 Region: 26-141
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-19
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Domain Number 7 Region: 154-314
Classification Level Classification E-value
Superfamily EF-hand 0.000000456
Family Calmodulin-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017588
Domain Number - Region: 485-523
Classification Level Classification E-value
Superfamily PH domain-like 0.000197
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017588   Gene: ENSMPUG00000017700   Transcript: ENSMPUT00000017847
Sequence length 1290
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:9321793:9356529:-1 gene:ENSMPUG00000017700 transcript:ENSMPUT00000017847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWVKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKNAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGRCGYVLQPSTMRDEAFDPFDKS
SLRGLEPYAVCIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSVKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLVKIELFPAKQENGDLSPFGMSLRERGSDASGPLFHGRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
Download sequence
Identical sequences M3Z1X6
ENSMPUP00000017588 XP_004746487.1.14098 ENSMPUP00000017588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]