SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017642 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017642
Domain Number 1 Region: 297-533
Classification Level Classification E-value
Superfamily VPS9 domain 9.02e-34
Family VPS9 domain 0.0039
Further Details:      
 
Domain Number 2 Region: 50-153
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000712
Family SH2 domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017642   Gene: ENSMPUG00000017754   Transcript: ENSMPUT00000017902
Sequence length 568
Comment pep:novel scaffold:MusPutFur1.0:GL897126.1:1515626:1520358:1 gene:ENSMPUG00000017754 transcript:ENSMPUT00000017902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLEDEASAGPINGERWVPSQVNGAGETPIGVLGTPEPLLRLWRTWGVWQVPELDIQDA
ETLLELWPPGSFLVTGHDPSQVLVLRTGASPGEIHTYQIQKLPGGVSLEYSNLCMPDLPH
LLAFLSASRDVLPRTLLLPPPTLRPEDQHTGPPQTGSVHLNVPERVLSMVNKLYLETHGG
WGKEQIPPETPPETEERHSSAPRNPAPHRVSWMEGPLSLEVHHSGPDLASLVEEKEKEDK
DEDGNKGNYKDEENGPEDVLTHHIQALARARGNYVGRQFQSLRARLTSNARGPHRPGDPA
TELLQDVRHLLTDLQDHLSKDPDVRAVFGSRGPGVPQKDYDLGAAVEAALCRAVLAPLKP
ALWARLRKLRAQELRRLRQRQIALRVGAGPPGCQGAGFEGPGPAPALRSRIHARLEHLHA
ACAPRRKVALLLAVCTDVYAGLAQGENQEPLGADAFLPALTEELIWSPHIGETQLDVEFL
MELLDPDELRGEAGYYLTTWFGALYHIAHYQPDAGRAPQGLSSEARASLRQWHSRRTLHR
QDRQDHAGAQVSLPFEEPWARDPVPRDQ
Download sequence
Identical sequences M3Z230
ENSMPUP00000017642 ENSMPUP00000017642 XP_004776272.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]