SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017664 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017664
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-32
Family SH2 domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 10-91
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000184
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017664   Gene: ENSMPUG00000017776   Transcript: ENSMPUT00000017924
Sequence length 276
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:13104388:13128975:1 gene:ENSMPUG00000017776 transcript:ENSMPUT00000017924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGQPSRGKTLPSPSSSPSVQEPGPVPMQAERSRATAVALGTFPVGEHTELPLSLGDPLT
IISEDGDWWTVVSDASGTEYSIPNSHVAKISHGWLYEGLSREKAEELLLLPGNSGGAFLI
RESQTRRGCYSLSVRLSRPTSWDRIRHYRIHRLDNGWLYISPRLTFPSLQALVDHYSELA
DGICCLLKEPCALRRAGPQPGKSIPPPVTVQSVPLNWKELDSSLLFSEAPTLGESPLLSE
GLREAISSYISLTDDSSLDDAMAQNRGQKGIQRCNT
Download sequence
Identical sequences M3Z252
XP_004746550.1.14098 ENSMPUP00000017664 ENSMPUP00000017664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]