SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017776 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017776
Domain Number 1 Region: 227-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-80
Family Protein kinases, catalytic subunit 0.000000000185
Further Details:      
 
Domain Number 2 Region: 117-259
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-38
Family SH2 domain 0.00000313
Further Details:      
 
Domain Number 3 Region: 59-141
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-22
Family SH3-domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017776   Gene: ENSMPUG00000017886   Transcript: ENSMPUT00000018036
Sequence length 504
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:16990911:17033393:-1 gene:ENSMPUG00000017886 transcript:ENSMPUT00000018036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCMKSKFLQDRGKVSKTEPSTNPHSPVYVPDPTSTSKRRPDNSNNIPPGSADVGPDDII
VIALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLVTRKEGYIPSNYVARINSLETE
EWFFKDISRKEAERQLLAPGNVLGSFMIRDSETTKGSYSLSVRDYDPQHRDTVKHYKIRT
LDSGGFYISPRSTFNTLQELVAHYKKGSDGLCQKLTVPCVSSKPQKPWEKDAWEIPRESL
KLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHA
VVTEEPIYIITEFMAKGSLLDFLKSTEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDL
RAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWS
FGILLMEIVTYGRIPYPGMTNPEVIRALERGYRMPRPEHCPEELYSIMTRCWKNRPEERP
TFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences M3Z2G4
ENSMPUP00000017776 ENSMPUP00000017776 XP_004746718.1.14098 XP_004746720.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]