SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018066 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018066
Domain Number 1 Region: 1414-1554
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-52
Family Phosphotyrosine-binding domain (PTB) 0.00000186
Further Details:      
 
Domain Number 2 Region: 286-414
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.92e-37
Family PLC-like (P variant) 0.0015
Further Details:      
 
Domain Number 3 Region: 119-282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-29
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Domain Number 4 Region: 1280-1401
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-23
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 5 Region: 29-78
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018066   Gene: ENSMPUG00000018178   Transcript: ENSMPUT00000018330
Sequence length 1560
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:12380459:12547923:1 gene:ENSMPUG00000018178 transcript:ENSMPUT00000018330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRALTSGPPGGCARGARARRHRHQPEELTSLHSFKNKVFKKPQVCGVCKQIIDSQGIA
CRACKYSCHKPCEAKVVTRRCAQVYLGQAPGASAPSAALCRARPSRPAGLSCTMEDGREL
DLTYITERIIAVSFPAGCSEESYLRGLQEVTRMLRSKHGDNYLVLNLSEKRYDLTKLNPK
ILDVGWPELHAPPLDQVCTICKAQETWLNSDPQHVVVIHCRGGKGRIGVVISSYMHFTNV
SASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGTVKMNASPLFLHFVILHG
TPNFDAGGVCRPFLKLYQAMQPVYTSGIYNVGPETQSSIYIAIEPAQLLKGDIMVKCYHK
KYRSATRDVIFRLQFHTGAVQSFGLVFGKEDLDNASQDDRFPDNGKIELLFSATPEKLKG
CEHLRNDHGVIVDFNTADPLIRWDSYESLSAGGEVPHTQGPVDGSLYAKVRKKSASDPGV
PGGSPGVPTASSPDHGDHTLSVSSDSGHSTASVRTDRTEEPLAVGSRRGLSPQEKAELDQ
LLSGFGLEDSGSPIKDMTDAPSKYSGTRHVVPAQVHVNGDATLKDRETDILDDEMPGHDL
HSVDSIGTLSSSEGHPSAHLGPFACHQSSQNSLLSEGFGSNPGEDAHGSLAPDLSLSVDP
LYERDRAFGTRECKQPPPVLRRPSVSAQTQAYGQSGYSTQTWVRQQQMVAAHQYSFAPDA
EARLVGRGPEDGPGLVQSQPRVPVTPTRGAGSRMAIQRSLGPGPQVPDAQRPPPGRAFKP
RFPDVRVVNGTGPEPSADPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNTLGSQV
NGPLPPDSGGGVLRASGLQDIGEGPGRASVRQGSSGDEPLGGRFRKLSLGQYDNDAGGQP
TFSRCGWGKTPGADQATGLASFLSPADAKETVAATYPRDPSGISGRTFTPTKGGADSASP
TPAFPVSPETPYVTTPPRYAPFTPPGPQAGSASGLYRDTHDTRGCAEILHRAAGMSESPG
GPRPAALRADVPAGPAFQRAFTSSCTVSSGGPGQRRDSPSSAELPWVESNPKATSALLGS
SRPAGSLSAEEFSSPGPDGPGRPHRPPAEFQASFHNHELSLAEPPEAVGPPGGQAFLSFG
TAPVGSGLPPAEDPGALLAHSHGAPQAPGTPRTAAADNGFLSHGFLTVTPGHSSHHSPVL
PGQGLTLPGQPPLPEKKRASEGDRSLGSASPSSSGFSSPHSGSTMSIPFPNVLPDFPKPL
EAAAPSPDNPGDKHVSVNFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGA
YGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVC
QHSITPLALPCKLLIPDRDPLEEIADSSPQTAANSATELLKQGAACNVWYLNSVEMESLT
GHQAIQKALSLTLVQEPPPLCTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDP
QDRKWITDGPCSRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPKKI
Download sequence
Identical sequences M3Z3A4
ENSMPUP00000018066 ENSMPUP00000018066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]