SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018174 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018174
Domain Number 1 Region: 31-57,174-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-60
Family G proteins 0.0000000675
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.93e-43
Family Transducin (alpha subunit), insertion domain 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018174   Gene: ENSMPUG00000018289   Transcript: ENSMPUT00000018441
Sequence length 355
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:24572616:24626463:-1 gene:ENSMPUG00000018289 transcript:ENSMPUT00000018441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEEECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPTSAEDQQQLCAMANTLQDGGMT
PELAEVIKRLWRDPGVQACFERASEYHLNDSAAYYLNDVDRITAPGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDGEV
NRMHESLHLFNSICNHKYFATTSIVLFLNKKDLFQEKVTKVHLSVCFPEYTEGPNTFEDA
GNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences M3Z3L2
ENSMPUP00000018174 ENSMPUP00000018174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]